| request information: |
|
| Catalog Code: | H00007083-M02 |
| Product Name: | TK1 Antibody |
| Product Description: | Mouse Monoclonal anti-TK1 (F12) |
| Clone: | F12 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 7083 |
| Gene Symbol: | TK1 |
| Omim ID: | 188300, |
| Immunogen: | TK1 (AAH07986, 1 a.a. ~ 235 a.a) full length recombinant protein with GST tag. |
| Epitope: | MSCINLPTVLPGSPSKTRGQIQVILGPMFSGKSTELMRRVRR FQIAQYKCLVIKYAKDTRYSSSFCTHDRNTMEALPACLLRDV AQEALGVAVIGIDEGQFFPDIVEFCEAMANAGKTVIVAALDG TFQRKPFGAILNLVPLAESVVKLTAVCMECFREAAYTKRLGT EKEVEVIGGADKYHSVCRLCYFKKASGQPAGPDNKENCPVPG KPGEAVAARKLFAPQQILQCSPAN* |
| Specificity: | TK1 - thymidine kinase 1, soluble |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin), RNAi validation and ELISA. |
| Localization: | Cytoplasmic |
| Background: | Thymidine kinase (TK) belongs to a group of enzymes such as dihydrofolate reductase, thymidylate synthase, and DNA polymerase that are involved in DNA synthesis and precursor production. Two forms have been identified in animal cells, one in cytosol and one in mitochondria. Activity of the cytosolic enzyme is high in proliferating cells and peaks during the S-phase of the cell cycle; it is very low in resting cells due to multiple regulatory mechanisms that ensure expression of these enzymes exclusively in replicating cells. TK is responsible for catalyzing the phosphorylation of thymidine, which functions as a part of the pyrimidine salvage pathway involved in DNA synthesis. The activities of enzymes such as TK are essential for the activation of several chemotherapeutically important nucleoside analogues that are administered as prodrugs. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a kappa |
| Host Name: | Mouse |
| Buffer: | Phosphate buffered saline, pH 7.2 |
| Application Summary: | ELISA, Immunohistochemistry-Paraffin, Western Blot, RNAi Validation |
| Species Summary: | Hu |
| Alternate Names: | anti-Thymidine Kinase antibody, anti-Thymidine kinase 1 antibody, anti-Thymidine kinase 1 soluble antibody, anti-Thymidine kinase cytosolic antibody, anti-TK 1 antibody, anti-TK 2 antibody, anti-TK1 antibody, anti-Tk1a antibody, anti-Tk1b antibody, anti-TK2 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
| Novus References: | Zhai, Y., et al. Gene Expression Analysis of Preinvasive and Invasive Cervical Squamous Cell Carcinomas Identifies HOXC10 as a Key Mediator of Invasion. Cancer Res. 2007 67: 10163-10172. |
order or
more information: | company product webpage |