| CatalogCode: | | H00007079-B01 |
| ProductName: | | TIMP4 Antibody |
| Product Description: | | Mouse Polyclonal anti-TIMP4 - TIMP metallopeptidase inhibitor 4, MaxPab Antibody |
| Clonality: | | Polyclonal |
| Immunogen: | | TIMP4 (AAH10553, 1 a.a. ~ 225 a.a) full-length human protein. |
| Epitope: | | MPGSPRPAPSWVLLLRLLALLRPPGLGEACSCAPAHPQQHICHSALVIRAKISSEKVVPASADPADTEKMLRYEIKQIKMFKGFEKVKDVQYIYTPFDSSLCGVKLEANSQKQYLLTGQVLSDGKVFIHLCNYIEPWEDLSLVQRESLNHHYHLNCGCQITTCYTVPCTISAPNECLWTDWLLERKLYGYQAQHYVCMKHVDGTCSWYRGHLPLRKEFVDIVQP* ... |
| CrossReactivity: | | Human. Other species not tested. |
| Packaging: | | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | | This gene belongs to the TIMP gene family. The proteins encoded by this gene family are inhibitors of the matrix metalloproteinases, a group of peptidases involved in degradation of the extracellular matrix. The secreted, netrin domain-containing protein encoded by this gene is involved in regulation of platelet aggregation and recruitment and may play role in hormonal regulation and endometrial tissue remodeling. |
| Storage: | | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host_Name: | | Mouse |
| ListPrice: | | 295 |
| AppSummary: | | WB, ELISA |
| SpeciesSummary: | | Hu |
| ProteinTarget: | | TIMP metallopeptidase inhibitor 4 |
| PackageSize: | | 0.05 ml |
| NotesMain: | | This antibody is available only in North America and is supplied by Abnova. Lead time may be 10-14 days. The immunizing protein may also available for this product. Unit cost for the protein is $250 (2 ug), $305 (10 ug), and $445 (25 ug). MaxPab is a registered trademark of Abnova. |
| Gene_Id: | | 7079 |
| Gene_Symbol: | | TIMP4 |
| more information: | | company product webpage |