ExactAntigen

TIAL1 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00007073-B01
Product Type:Primary Antibody
Product Name:TIAL1 Antibody
List Price:295
Clonality:Polyclonal
Gene ID:7073
Host:Mouse
Product Description:Mouse Polyclonal anti-TIAL1 - TIA1 cytotoxic granule-associated RNA binding protein-like 1, MaxPab Antibody
Cross Reactivity:Human.
Species Summary:Hu(+)
Background:The protein encoded by this gene is a member of a family of RNA-binding proteins, has three RNA recognition motifs (RRMs), and binds adenine and uridine-rich elements in mRNA and pre-mRNAs of a wide range of genes. It regulates various activities including translational control, splicing and apoptosis. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. The different isoforms have been show to function differently with respect to post-transcriptional silencing.
Alternate Names:anti-MGC33401 antibody, anti-TCBP antibody, anti-TIAR antibody
Immunogen:TIAL1 (-, 1 a.a. ~ 252 a.a) full-length human protein.
Epitope:MDARVVKDMATGKSKGYGFVSFYNKLDAENAIVHMGGQWLGGRQIRTNWATRKPPAPKSTQENNTKQLRFEDVVNQSSPKNCTVYCGGIASGLTDQLMRQTFSPFGQIMEIRVFPEKGYSFVRFSTHESAAHAIVSVNGTTIEGHVVKCYWGKESPDMTKNFQQVDYSQWGQWSQVYGNPQQYGQYMANGWQVPPYGVYGQPWNQQGFGVDQSPSAAWMGGFGAQPPQGQAPPPVIPPPNQAGYGMASYQTQ ...
Preservative:No Preservative
Packaging:0.05 ml of mouse antisera with 50% glycerol.
PackageSize:0.05 ml
Uses:Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.
Application Summary:Western Blot 1:500, ELISA
Storage:Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
WebLink:www.novusbio.com/data_sheet/index ...
see all human TIAR antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about