| Catalog Code: | H00007073-B01 |
| Product Type: | Primary Antibody |
| Product Name: | TIAL1 Antibody |
| List Price: | 295 |
| Clonality: | Polyclonal |
| Gene ID: | 7073 |
| Host: | Mouse |
| Product Description: | Mouse Polyclonal anti-TIAL1 - TIA1 cytotoxic granule-associated RNA binding protein-like 1, MaxPab Antibody |
| Cross Reactivity: | Human. |
| Species Summary: | Hu(+) |
| Background: | The protein encoded by this gene is a member of a family of RNA-binding proteins, has three RNA recognition motifs (RRMs), and binds adenine and uridine-rich elements in mRNA and pre-mRNAs of a wide range of genes. It regulates various activities including translational control, splicing and apoptosis. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. The different isoforms have been show to function differently with respect to post-transcriptional silencing. |
| Alternate Names: | anti-MGC33401 antibody, anti-TCBP antibody, anti-TIAR antibody |
| Immunogen: | TIAL1 (-, 1 a.a. ~ 252 a.a) full-length human protein. |
| Epitope: | MDARVVKDMATGKSKGYGFVSFYNKLDAENAIVHMGGQWLGGRQIRTNWATRKPPAPKSTQENNTKQLRFEDVVNQSSPKNCTVYCGGIASGLTDQLMRQTFSPFGQIMEIRVFPEKGYSFVRFSTHESAAHAIVSVNGTTIEGHVVKCYWGKESPDMTKNFQQVDYSQWGQWSQVYGNPQQYGQYMANGWQVPPYGVYGQPWNQQGFGVDQSPSAAWMGGFGAQPPQGQAPPPVIPPPNQAGYGMASYQTQ ... |
| Preservative: | No Preservative |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| PackageSize: | 0.05 ml |
| Uses: | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
| Application Summary: | Western Blot 1:500, ELISA |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| WebLink: | www.novusbio.com/data_sheet/index ... |