| request information: |
|
| Catalog Code: | H00007073-A01 |
| Product Name: | TIAL1 Antibody |
| Product Description: | Mouse Polyclonal anti-TIAL1 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 7073 |
| Gene Symbol: | TIAL1 |
| Omim ID: | 603413 |
| Immunogen: | TIAL1 (NP_003243, 1 a.a. ~ 91 a.a) partial recombinant protein with GST tag. |
| Epitope: | MMEDDGQPRTLYVGNLSRDVTEVLILQLFSQIGPCKSCKMITEHTSNDPYCFVEFYEHRDAAAALAAMNGRKILGKEVK
VNWATTPSSQK* |
| Specificity: | TIAL1 - TIA1 cytotoxic granule-associated RNA binding protein-like 1 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | The protein encoded by this gene is a member of a family of RNA-binding proteins, has three RNA recognition motifs (RRMs), and binds adenine and uridine-rich elements in mRNA and pre-mRNAs of a wide range of genes. It regulates various activities including translational control, splicing and apoptosis. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. The different isoforms have been show to function differently with respect to post-transcriptional silencing. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-TCBP antibody, anti-TIAR antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |