| CatalogCode: | | H00007048-A01 |
| ProductName: | | TGFBR2 Antibody |
| Product Description: | | Mouse Polyclonal anti-TGFBR2 |
| Clonality: | | Polyclonal |
| Immunogen: | | TGFBR2 (NP_001020018, 62 a.a. ~ 166 a.a) partial recombinant protein with GST tag. |
| Epitope: | | IVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSS* ... |
| Specificity: | | Mouse polyclonal antibody raised against a partial recombinant TGFBR2. |
| CrossReactivity: | | Human. Other species not tested. |
| Packaging: | | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | | The quality control of this antibody is limited to Western blot on the immunizing protein and cell lysates. Abnova's recommended working dilutions for western analysis are as follows:
1:500-1:1000 for polysera |
| Background: | | This gene encodes a member of the Ser/Thr protein kinase family and the TGFB receptor subfamily. The encoded protein is a transmembrane protein that has a protein kinase domain, forms a heterodimeric complex with another receptor protein, and binds TGF-beta. This receptor/ligand complex phosphorylates proteins, which then enter the nucleus and regulate the transcription of a subset of genes related to cell proliferation. Mutations in this gene have been associated with Marfan Syndrome, Loeys-Deitz Aortic Aneurysm Syndrome, and the development of various types of tumors. Alternatively spliced transcript variants encoding different isoforms have been characterized. |
| Storage: | | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | | Whole antisera |
| Host_Name: | | Mouse |
| ListPrice: | | 225 |
| AppSummary: | | ELISA, WB |
| SpeciesSummary: | | Hu |
| ALTnames: | | anti-HNPCC6 antibody, anti-MFS2 antibody, anti-RIIC antibody, anti-TGFR2 antibody, anti-TGFbetaRII antibody |
| ProteinTarget: | | TGFBR2 |
| PackageSize: | | 0.05 ml |
| NotesMain: | | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | | 7048 |
| Gene_Symbol: | | TGFBR2 |
| Omim_ID: | | 133239, 190182, 609192, |
| more information: | | company product webpage |