| request information: |
|
| Catalog Code: | H00007039-A01 |
| Product Name: | TGFA Antibody |
| Product Description: | Mouse Polyclonal anti-TGFA |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 7039 |
| Gene Symbol: | TGFA |
| Omim ID: | 190170, |
| Immunogen: | TGFA (NP_003227, 42 a.a. ~ 90 a.a) partial recombinant protein with GST tag. |
| Epitope: | SHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLA* |
| Specificity: | TGFA - transforming growth factor, alpha |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | Transforming growth factors (TGFs) are biologically active polypeptides that reversibly confer the transformed phenotype on cultured cells. TGF-alpha shows about 40% sequence homology with epidermal growth factor (EGF; MIM 131530) and competes with EGF for binding to the EGF receptor (MIM 131550), stimulating its phosphorylation and producing a mitogenic response.[supplied by OMIM] |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-TFGA antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |