| request information: |
|
| Catalog Code: | H00007037-M01 |
| Product Name: | TFRC Antibody |
| Product Description: | Mouse Monoclonal anti-TFRC (1E6) |
| Clone: | 1E6 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 7037 |
| Gene Symbol: | TFRC |
| Omim ID: | 190010, |
| Immunogen: | TFRC (AAH01188, 68 a.a. ~ 168 a.a) partial recombinant protein with GST tag. |
| Epitope: | YGTIAVIVFFLIGFMIGYLGYCKGVEPKTECERLAGTESPVREEPGEDFPAARRLYWDDLKRKLSEKLDSTDFTGTIKL
LNENSYVPREAGSQKDENLALY |
| Specificity: | TFRC - transferrin receptor (p90, CD71) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2b Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Immunohistochemistry-Paraffin, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-CD71 antibody, anti-TFR antibody, anti-TFR1 antibody, anti-TRFR antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |