ExactAntigen

TEK Antibody | Novus Biologicals antibody product information
request information:
Catalog Code:H00007010-M11
Product Name:TEK Antibody
Product Description:Mouse Monoclonal anti-TEK (6G9)
Clone:6G9
Clonality:Monoclonal
ListPrice:295
Gene ID:7010
Gene Symbol:TEK
Omim ID:600195, 600221,
Immunogen:TEK (AAH35514, 701 a.a. ~ 800 a.a) partial recombinant protein with GST tag.
Epitope:AFSHELVTLPESQAPADLGGGKMLLIAILGSAGMTCLTVLLAFLIILQLKRANVQRRMAQAFQNVREEPAVQFNSGTLA
LNRKVKNNPDPTIYPVLDWND
Specificity:TEK - TEK tyrosine kinase, endothelial (venous malformations, multiple cutaneous and mucosal)
Cross Reactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Background:The TEK receptor tyrosine kinase is expressed almost exclusively in endothelial cells in mice, rats, and humans. This receptor possesses a unique extracellular domain containing 2 immunoglobulin-like loops separated by 3 epidermal growth factor-like repeats that are connected to 3 fibronectin type III-like repeats. The ligand for the receptor is angiopoietin-1. Defects in TEK are associated with inherited venous malformations; the TEK signaling pathway appears to be critical for endothelial cell-smooth muscle cell communication in venous morphogenesis. TEK is closely related to the TIE receptor tyrosine kinase.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG2a Kappa
Host Name:Mouse
Application Summary:ELISA, Western Blot
Species Summary:Hu
Alternate Names:anti-CD202B antibody, anti-TIE-2 antibody, anti-TIE2 antibody, anti-VMCM antibody, anti-VMCM1 antibody
Package Size:0.1 mg
Preservative:No preservative
order or
more information
:
company product webpage
Also see:
all human TEK antibodies


2008©ExactAntigen home | browse | about