| request information: | |
| Catalog Code: | H00007010-M05 |
| Product Name: | TEK Antibody |
| Product Description: | Mouse Monoclonal anti-TEK (2D2) |
| Clone: | 2D2 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 7010 |
| Gene Symbol: | TEK |
| Omim ID: | 600195, 600221, |
| Immunogen: | TEK (AAH35514, 701 a.a. ~ 800 a.a) partial recombinant protein with GST tag. |
| Epitope: | AFSHELVTLPESQAPADLGGGKMLLIAILGSAGMTCLTVLLAFLIILQLKRANVQRRMAQAFQNVREEPAVQFNSGTLA LNRKVKNNPDPTIYPVLDWND |
| Specificity: | TEK - TEK tyrosine kinase, endothelial (venous malformations, multiple cutaneous and mucosal) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | The TEK receptor tyrosine kinase is expressed almost exclusively in endothelial cells in mice, rats, and humans. This receptor possesses a unique extracellular domain containing 2 immunoglobulin-like loops separated by 3 epidermal growth factor-like repeats that are connected to 3 fibronectin type III-like repeats. The ligand for the receptor is angiopoietin-1. Defects in TEK are associated with inherited venous malformations; the TEK signaling pathway appears to be critical for endothelial cell-smooth muscle cell communication in venous morphogenesis. TEK is closely related to the TIE receptor tyrosine kinase. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-CD202B antibody, anti-TIE-2 antibody, anti-TIE2 antibody, anti-VMCM antibody, anti-VMCM1 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or more information: | company product webpage |