| request information: |
|
| Catalog Code: | H00006935-M01 |
| Product Name: | transcription factor 8 Antibody |
| Product Description: | Mouse Monoclonal anti-transcription factor 8 (4C4) |
| Clone: | 4C4 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 6935 |
| Gene Symbol: | TCF8 |
| Omim ID: | 189909, 609141, |
| Immunogen: | TCF8 (NP_110378, 801 a.a. ~ 901 a.a) partial recombinant protein with GST tag. |
| Epitope: | NIAIPTVTAQLPTIVAIADQNSVPCLRALAANKQTILIPQVAYTYSTTVSPAVQEPPLKVIQPNGNQDERQDTSSEGVS
NVEDQNDSDSTPPKKKMRKTE* |
| Specificity: | transcription factor 8 (represses interleukin 2 expression) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | ZEB1 encodes a zinc finger transcription factor that represses T-lymphocyte-specific IL2 gene (MIM 147680) expression by binding to a negative regulatory domain 100 nucleotides 5-prime of the IL2 transcription start site (Williams et al., 1991 [PubMed 1840704]).[supplied by OMIM] |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Buffer: | 1X PBS pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-AREB6 antibody, anti-BZP antibody, anti-NIL-2-A antibody, anti-NIL-2A antibody, anti-PPCD3 antibody, anti-ZEB antibody, anti-ZEB1 antibody, anti-ZFHEP antibody, anti-ZFHX1A antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |