| request information: | |
| Catalog Code: | H00006928-M02 |
| Product Name: | TCF2 Antibody |
| Product Description: | Mouse Monoclonal anti-TCF2 - transcription factor 2, hepatic; LF-B3; variant hepatic nuclear factor (3E11) |
| Clone: | 3E11 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 6928 |
| Gene Symbol: | TCF2 |
| Immunogen: | TCF2 (NP_000449, 29 a.a. ~ 118 a.a) partial recombinant protein with GST tag. |
| Epitope: | ALEELLPSPNFGVKLETLPLSPGSGAEPDTKPVFHTLTNGHAKGRLSGDEGSEDGDDYDTPPILKELQALNTEEAAEQR AEVDRMLSEDP |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against tissue lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | This gene encodes a member of the transcription factor superfamily. The encoded protein forms heterodimers with another member of this transcription factor family, HNF1A. Multiple alternatively spliced transcript variants have been described, however the biological validity all of these variants needs to be determined. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-HNF1B antibody, anti-HNF1beta antibody, anti-HNF2 antibody, anti-LFB3 antibody, anti-MODY5 antibody, anti-VHNF1 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No Preservative |
order or more information: | company product webpage |