| Catalog Code: | H00006924-M02 |
| Product Type: | Primary Antibody |
| Product Name: | TCEB3 Antibody |
| List Price: | 275 |
| Clonality: | Monoclonal |
| Gene ID: | 6924 |
| Host: | Mouse |
| Clone: | 1F3 |
| Isotype: | IgG2a Kappa |
| Product Description: | Mouse Monoclonal anti-TCEB3 (1F3) |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | This gene encodes the protein elongin A, which is a subunit of the transcription factor B (SIII) complex. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymera |
| Alternate Names: | anti-SIII antibody, anti-TCEB3A antibody |
| Immunogen: | TCEB3 (NP_003189, 81 a.a. ~ 191 a.a) partial recombinant protein with GST tag. |
| Epitope: | NAEPDEQDFEKSNSRKRPRDALQKEEEMEGDYQETWKATGSRSYSPDHRQKKHRKLSELERPHKVSHGHERRDERKRCHRMSPTYSSDPESSDYGHVQSPPSCTSPHQMY* ... |
| Purity: | IgG purified |
| Buffer: | In 1x PBS, pH 7.2 |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Package Size: | 0.1 mg |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. |
| Application Summary: | ELISA, WB |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug). |
| Gene Symbol: | TCEB3 |
| Omim ID: | 600786, |