| request information: |
|
| Catalog Code: | H00006924-M01 |
| Product Name: | TCEB3 Antibody |
| Product Description: | Mouse Monoclonal anti-TCEB3 (3E2) |
| Clone: | 3E2 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 6924 |
| Gene Symbol: | TCEB3 |
| Omim ID: | 600786, |
| Immunogen: | TCEB3 (NP_003189, 81 a.a. ~ 191 a.a) partial recombinant protein with GST tag. |
| Epitope: | NAEPDEQDFEKSNSRKRPRDALQKEEEMEGDYQETWKATGSR SYSPDHRQKKHRKLSELERPHKVSHGHERRDERKRCHRMSPT YSSDPESSDYGHVQSPPSCTSPHQMY* |
| Specificity: | TCEB3 - transcription elongation factor B (SIII), polypeptide 3 (110kDa, elongin A) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Localization: | Nuclear |
| Background: | This gene encodes the protein elongin A, which is a subunit of the transcription factor B (SIII) complex. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units. Elongin A functions as the transcriptionally active component of the SIII complex, whereas elongins B and C are regulatory subunits. Elongin A2 is specifically expressed in the testis, and capable of forming a stable complex with elongins B and C. The von Hippel-Lindau tumor suppressor protein binds to elongins B and C, and thereby inhibits transcription elongation. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Buffer: | Phosphate buffered saline, pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-Elongin A antibody, anti-Ela1 antibody, anti-Elo A antibody, anti-EloA antibody, anti-Elongin 110 kDa subunit antibody, anti-ElonginA antibody, anti-RNA polymerase II transcription factor SIII subunit A1 antibody, anti-SIII antibody, anti-SIII p110 antibody, anti-TCEB 3 antibody, anti-TCEB3 antibody, anti-TCEB3A antibody, anti-Transcription elongation factor B (SIII) polypeptide 3 (110kD) antibody, anti-Transcription elongation factor B (SIII) polypeptide 3 antibody, anti-Transcription elongation factor B alpha subunit antibody, anti-Transcription elongation factor B polypeptide 3 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |
|