| CatalogCode: | H00006924-A01 |
| ProductName: | TCEB3 Antibody |
| Product Description: | Mouse Polyclonal anti-TCEB3 |
| Clonality: | Polyclonal |
| Immunogen: | TCEB3 (NP_003189, 81 a.a. ~ 191 a.a) partial recombinant protein with GST tag. |
| Epitope: | NAEPDEQDFEKSNSRKRPRDALQKEEEMEGDYQETWKATGSRSYSPDHRQKKHRKLSELERPHKVSHGHERRDERKRCHRMSPTYSSDPESSDYGHVQSPPSCTSPHQMY* ... |
| Specificity: | TCEB3 - transcription elongation factor B (SIII), polypeptide 3 (110kDa, elongin A) |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnova's recommended working dilutions for western analysis are as follows: 1:500 dilution for ascites 1:1000 for purified Ig 1:500-1:1000 for polysera |
| Background: | This gene encodes the protein elongin A, which is a subunit of the transcription factor B (SIII) complex. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units. Elongin A functions as the transcriptionally active component of the SIII complex, whereas elongins B and C are regulatory subunits. Elongin A2 is specifically expressed in the testis, and capable of forming a stable complex with elongins B and C. The von Hippel-Lindau tumor suppressor protein binds to elongins B and C, and thereby inhibits transcription elongation. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host_Name: | Mouse |
| ListPrice: | 225 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-TCEB3 antibody, anti-TCEB-3 antibody, anti-Transcription Elongation Factor B (SIII) antibody, anti-Polypeptide 3 antibody, anti-TCEB3A antibody, anti-Transcription Elongation Factor B alpha subunit antibody, anti-EloA antibody, anti-110kDa Elongin A antibody, anti-SIII antibody |
| ProteinTarget: | TCEB3 - transcription elongation factor B (SIII), polypeptide 3 (110kDa, elongin A) |
| PackageSize: | 0.05 ml |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 6924 |
| Gene_Symbol: | TCEB3 |
| Omim_ID: | 600786 H00006924-M02 |