| request information: |
|
| Catalog Code: | H00006921-A01 |
| Product Name: | TCEB1 Antibody |
| Product Description: | Mouse Polyclonal anti-TCEB1 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 6921 |
| Gene Symbol: | TCEB1 |
| Omim ID: | 600788 |
| Immunogen: | TCEB1 (AAH13809, 1 a.a. ~ 113 a.a) full length recombinant protein with GST tag. |
| Epitope: | MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTY
KVRYTNSSTEIPEFPIAPEIALELLMAANFLDC* |
| Specificity: | TCEB1 - transcription elongation factor B (SIII), polypeptide 1 (15kDa, elongin C) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | This gene encodes the protein elongin C, which is a subunit of the transcription factor B (SIII) complex. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units. Elongin A functions as the transcriptionally active component of the SIII complex, whereas elongins B and C are regulatory subunits. Elongin A2 is specifically expressed in the testis, and capable of forming a stable complex with elongins B and C. The von Hippel-Lindau tumor suppressor protein binds to elongins B and C, and thereby inhibits transcription elongation. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-SIII antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |