ExactAntigen

Mouse Monoclonal anti-TAZ (1E5) | Novus Biologicals antibody product information
CatalogCode:H00006901-M20
ProductName:TAZ Antibody
Product Description:Mouse Monoclonal anti-TAZ (1E5)
Clone:1E5
Clonality:Monoclonal
Immunogen:TAZ (AAH11515, 1 a.a. ~ 263 a.a) full length recombinant protein with GST tag.
Epitope:MPLHVKWPFPAVPPLTWTLASSVVMGLVGTYSCFWTSEWAQAEAGPPGYPCPAGGILKLRHIWNLKLMRWTPAAADICFTKELHSHFFSLGKCVPVCRGDGVYQKGMDFILEKLNHGDWVHIFPEGIGRLIAECHLNPIILPLWHVGEPGDGDREMASGVGGLGLPLVPGCPAPPHVWPSVHCAAGMNDVLPNSPPYFPRFGQKITVLIGKPFSALPVLERLRAENKSAVEMRKALTDFIQEEFQHLKTQAEQLH ...
CrossReactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody reactive against recombinant protein on ELISA.
Background:This gene encodes a protein that is expressed at high levels in cardiac and skeletal muscle. Mutations in this gene have been associated with a number of clinical disorders including Barth syndrome, dilated cardiomyopathy (DCM), hypertrophic DCM, endocardial fibroelastosis, and left ventricular noncompaction (LVNC). Multiple transcript variants encoding different isoforms have been described. A long form and a short form of each of these isoforms is produced; the short form lacks a hydrophobic leader sequence and may exist as a cytoplasmic protein rather than being membrane-bound. Other alternative transcripts encoding additional isoforms have been described but the full-length nature of these transcripts is not known.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG2a Kappa
Host_Name:Mouse
Buffer:In 1x PBS, pH 7.2
ListPrice:295
AppSummary:ELISA
SpeciesSummary:Hu
ALTnames:anti-BTHS antibody, anti-CMD3A antibody, anti-EFE antibody, anti-EFE2 antibody, anti-G4.5 antibody, anti-LVNCX antibody, anti-XAP-2 antibody
ProteinTarget:tafazzin (cardiomyopathy, dilated 3A (X-linked); endocardial fibroelastosis 2; Barth syndrome)
PackageSize:0.1 mg
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:6901
Gene_Symbol:TAZ
Omim_ID:300069, 300183, 300394, 302060,
order or
more information
:
company product webpage
request information:
Also see:
all human TAZ antibodies
anti mouse secondary antibodies


2008©ExactAntigen home | browse | about