| request information: | |
| Catalog Code: | H00006901-M17 |
| Product Name: | TAZ Antibody |
| Product Description: | Mouse Monoclonal anti-TAZ (3A11) |
| Clone: | 3A11 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 6901 |
| Gene Symbol: | TAZ |
| Omim ID: | 300069, 300183, 300394, 302060, |
| Immunogen: | TAZ (AAH11515, 1 a.a. ~ 263 a.a) full length recombinant protein with GST tag. |
| Epitope: | MPLHVKWPFPAVPPLTWTLASSVVMGLVGTYSCFWTSEWAQAEAGPPGYPCPAGGILKLRHIWNLKLMRWTPAAADICF TKELHSHFFSLGKCVPVCRGDGVYQKGMDFILEKLNHGDWVHIFPEGIGRLIAECHLNPIILPLWHVGEPGDGDREMAS GVGGLGLPLVPGCPAPPHVWPSVHCAAGMNDVLPNSPPYFPRFGQKITVLIGKPFSALPVLERLRAENKSAVEMRKALT DFIQEEFQHLKTQAEQLH |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein on ELISA. |
| Background: | This gene encodes a protein that is expressed at high levels in cardiac and skeletal muscle. Mutations in this gene have been associated with a number of clinical disorders including Barth syndrome, dilated cardiomyopathy (DCM), hypertrophic DCM, endocardial fibroelastosis, and left ventricular noncompaction (LVNC). Multiple transcript variants encoding different isoforms have been described. A long form and a short form of each of these isoforms is produced; the short form lacks a hydrophobic leader sequence and may exist as a cytoplasmic protein rather than being membrane-bound. Other alternative transcripts encoding additional isoforms have been described but the full-length nature of these transcripts is not known. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| Application Summary: | ELISA |
| Species Summary: | Hu |
| Alternate Names: | anti-BTHS antibody, anti-CMD3A antibody, anti-EFE antibody, anti-EFE2 antibody, anti-G4.5 antibody, anti-XAP-2 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or more information: | company product webpage |