| request information: |
|
| Catalog Code: | H00006900-A01 |
| Product Name: | CNTN2 Antibody |
| Product Description: | Mouse Polyclonal anti-CNTN2 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 6900 |
| Gene Symbol: | CNTN2 |
| Omim ID: | 190197 |
| Immunogen: | CNTN2 (NP_005067, 825 a.a. ~ 924 a.a) partial recombinant protein with GST tag. |
| Epitope: | SSSEMNVTWEPVQQDMNGILLGYEIRYWKAGDKEAAADRVRTAGLDTSARVSGLHPNTKYHVTVRAYNRAGTGPASPSA
NATTMKPPPRRPPGNISWTF* |
| Specificity: | CNTN2 - contactin 2 (axonal) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml Whole antisera Mouse antisera. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. <br>Abnovas recommended working dilutions for western analysis are as follows:<br>1:500 dilution for ascites<br>1:1000 for purified Ig<br>1:500-1:1000 for polysera |
| Background: | The protein encoded by this gene is a member of the immunoglobulin superfamily. It is a glycosylphosphatidylinositol (GPI)-anchored neuronal membrane protein that functions as a cell adhesion molecule. It may play a role in the formation of axon connections in the developing nervous system. It may also be involved in glial tumorigenesis and may provide a potential target for therapeutic intervention. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-AXT antibody, anti-DKFZp781D102 antibody, anti-TAG-1 antibody, anti-TAX antibody, anti-TAX1 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |