ExactAntigen

CNTN2 Antibody | Novus Biologicals antibody product information
request information:
Catalog Code:H00006900-A01
Product Name:CNTN2 Antibody
Product Description:Mouse Polyclonal anti-CNTN2
Clonality:Polyclonal
ListPrice:225
Gene ID:6900
Gene Symbol:CNTN2
Omim ID:190197
Immunogen:CNTN2 (NP_005067, 825 a.a. ~ 924 a.a) partial recombinant protein with GST tag.
Epitope:SSSEMNVTWEPVQQDMNGILLGYEIRYWKAGDKEAAADRVRTAGLDTSARVSGLHPNTKYHVTVRAYNRAGTGPASPSA
NATTMKPPPRRPPGNISWTF*
Specificity:CNTN2 - contactin 2 (axonal)
Cross Reactivity:Human. Other species not tested.
Packaging:0.05 ml Whole antisera Mouse antisera.
Uses:The quality control of this antibody is limited to Western blot on the immunizing protein. <br>Abnovas recommended working dilutions for western analysis are as follows:<br>1:500 dilution for ascites<br>1:1000 for purified Ig<br>1:500-1:1000 for polysera
Background:The protein encoded by this gene is a member of the immunoglobulin superfamily. It is a glycosylphosphatidylinositol (GPI)-anchored neuronal membrane protein that functions as a cell adhesion molecule. It may play a role in the formation of axon connections in the developing nervous system. It may also be involved in glial tumorigenesis and may provide a potential target for therapeutic intervention.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:Whole antisera
Host Name:Mouse
Application Summary:ELISA, Western Blot
Species Summary:Hu
Alternate Names:anti-AXT antibody, anti-DKFZp781D102 antibody, anti-TAG-1 antibody, anti-TAX antibody, anti-TAX1 antibody
Package Size:0.05 ml
Preservative:No preservative
order or
more information
:
company product webpage
Also see:
all human CNTN2 antibodies


2008©ExactAntigen home | browse | about