ExactAntigen

TAF12 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00006883-B01
Product Type:Primary Antibody
Product Name:TAF12 Antibody
List Price:275
Clonality:Polyclonal
Gene ID:6883
Host:Mouse
Product Description:Mouse Polyclonal anti-TAF12
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:Control of transcription by RNA polymerase II involves the basal transcription machinery which is a collection of proteins. These proteins with RNA polymerase II, assemble into complexes which are modulated by transactivator proteins that bind to cis-regu
Alternate Names:anti-TAF2J antibody, anti-TAFII20 antibody
Immunogen:TAF12 (AAH11986, 1 a.a. ~ 162 a.a) full-length human protein.
Epitope:MNQFGPSALINLSNFSSIKPEPASTPPQGSMANSTAVVKIPGTPGAGGRLSPENNQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTTKK* ...
Specificity:Mouse polyclonal antibody raised against a full-length human TAF12 protein.
Purity:Whole antisera
Packaging:50 ul of mouse antisera with 50% glycerol.
Package Size:0.05 ml
Uses:The quality control of this antibody is limited to Western blot on transfected lysate. Abnova's recommended working dilutions for western analysis are as follows:1:500-1:1000 for polysera
Application Summary:WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug). MaxPab is a registered trademark of Abno
Gene Symbol:TAF12
Omim ID:600773,
see all human TAF12 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about