| Catalog Code: | H00006882-M06 |
| Product Type: | Primary Antibody |
| Product Name: | TAF11 Antibody |
| List Price: | 275 |
| Clonality: | Monoclonal |
| Gene ID: | 6882 |
| Host: | Mouse |
| Clone: | 3G6 |
| Isotype: | IgG1 Kappa |
| Product Description: | Mouse Monoclonal anti-TAF11 (3G6) |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, |
| Alternate Names: | anti-MGC:15243 antibody, anti-PRO2134 antibody, anti-TAF2I antibody, anti-TAFII28 antibody |
| Immunogen: | TAF11 (NP_005634, 158 a.a. ~ 211 a.a) partial recombinant protein with GST tag. |
| Epitope: | SKVFVGEVVEEALDVCEKWGEMPPLQPKHMREAVRRLKSKGQIPNSKHKKIIF* ... |
| Purity: | IgG purified |
| Buffer: | In 1x PBS, pH 7.2 |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Package Size: | 0.1 mg |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. |
| Application Summary: | ELISA, WB |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug). |
| Gene Symbol: | TAF11 |
| Omim ID: | 600772, |