| request information: |
|
| Catalog Code: | H00006879-M02 |
| Product Name: | TAF7 Antibody |
| Product Description: | Mouse Monoclonal anti-TAF7 (3G6) |
| Clone: | 3G6 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 6879 |
| Gene Symbol: | TAF7 |
| Omim ID: | 600573, |
| Immunogen: | TAF7 (AAH32737, 130 a.a. ~ 224 a.a) partial recombinant protein with GST tag. |
| Epitope: | FIWNHGITLPLKNVRKRRFRKTAKKKYIESPDVEKEVKRLLSTDAEAVSTRWEIIAEDETKEAENQGLDISSPGMSGHR
QGHDSLEHDELREIFN |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | The intronless gene for this transcription coactivator is located between the protocadherin beta and gamma gene clusters on chromosome 5. The protein encoded by this gene is a component of the TFIID protein complex, a complex which binds to the TATA box in class II promoters and recruits RNA polymerase II and other factors. This particular subunit interacts with the largest TFIID subunit, as well as multiple transcription activators. The protein is required for transcription by promoters targeted by RNA polymerase II. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-TAF2F antibody, anti-TAFII55 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No Preservative |
order or
more information: | company product webpage |