| request information: |
|
| Catalog Code: | H00006872-M01 |
| Product Name: | TAF1 Antibody |
| Product Description: | Mouse Monoclonal anti-TAF1 (1E11) |
| Clone: | 1E11 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 6872 |
| Gene Symbol: | TAF1 |
| Omim ID: | 313650 |
| Immunogen: | TAF1 (NP_004597, 1784 a.a. ~ 1894 a.a) partial recombinant protein with GST tag. |
| Epitope: | RMLQENTRMDMENEESMMSYEGDGGEASHGLEDSNISYGSYEEPDPKSNTQDTSFSSIGGYEVSEEEEDEEEEEQRSGP
SVLSQVHLSEDEEDSEDFHSIAGDSDLDSDE* |
| Specificity: | TAF1 - TAF1 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 250kDa |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is the basal transcription factor TFIID, which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes the largest subunit of TFIID. This subunit binds to core promoter sequences encompassing the transcription start site. It also binds to activators and other transcriptional regulators, and these interactions affect the rate of transcription initiation. This subunit contains two independent protein kinase domains at the N and C-terminals, but also possesses acetyltransferase activity and can act as a ubiquitin-activating/conjugating enzyme. Two transcripts encoding different isoforms have been identified for this gene. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-BA2R antibody, anti-CCG1 antibody, anti-CCGS antibody, anti-NSCL2 antibody, anti-OF antibody, anti-P250 antibody, anti-TAF2A antibody, anti-TAFII250 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |