| request information: |
|
| Catalog Code: | H00006871-M01 |
| Product Name: | TADA2L Antibody |
| Product Description: | Mouse Monoclonal anti-TADA2L (4A8-1A7) |
| Clone: | 4A8-1A7 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 6871 |
| Gene Symbol: | TADA2L |
| Omim ID: | 602276 |
| Immunogen: | TADA2L (AAH01172, 1 a.a. ~ 306 a.a) full length recombinant protein with GST tag. |
| Epitope: | MDRLGSFSNDPSDKPPCRGCSSYLMEPYIKCAECGPPPFFLCLQCFTRGFEYKKHQSDHTYEIMTSDFPVLDPSWTAQE
EMALLEAVMDCGFGNWQDVANQMCTKTKEECEKHYMKYFINNPLFASTLLNLKQAEEAKTADTAIPFHSTDDPPRPTFD
SLLSRDMAGYMPARADFIEEFDNYAEWDLRDIDFVEDDSDILHALKMAVVDIYHSRLKERQRRKKIIRDHGLINLRKFQ
LMERRYPKEVQDLYETMR |
| Specificity: | TADA2L - transcriptional adaptor 2 (ADA2 homolog, yeast)-like |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | Many DNA-binding transcriptional activator proteins enhance the initiation rate of RNA polymerase II-mediated gene transcription by interacting functionally with the general transcription machinery bound at the basal promoter. Adaptor proteins are usually required for this activation, possibly to acetylate and destabilize nucleosomes, thereby relieving chromatin constraints at the promoter. The protein encoded by this gene is a transcriptional activator adaptor and has been found to be part of the PCAF histone acetylase complex. Two transcript variants encoding different isoforms have been identified for this gene. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-ADA2 antibody, anti-FLJ12705 antibody, anti-KL04P antibody, anti-hADA2 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |