| CatalogCode: | H00006869-M10 |
| ProductName: | Tachykinin Receptor 1 Antibody |
| Product Description: | Mouse Monoclonal anti-Tachykinin Receptor 1 (1F7) |
| Clone: | 1F7 |
| Clonality: | Monoclonal |
| Immunogen: | TACR1 (NP_001049, 140 a.a. ~ 244 a.a) partial recombinant protein with GST tag. |
| Epitope: | PRLSATATKVVICVIWVLALLLAFPQGYYSTTETMPSRVVCMIEWPEHPNKIYEKVYHICVTVLIYFLPLLVIGYAYTVVGITLWASEIPGDSSDRYHEQVSAK* ... |
| Specificity: | tachykinin receptor 1 |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein on ELISA. |
| Background: | This gene belongs to a family of genes that function as receptors for tachykinins. Receptor affinities are specified by variations in the 5'-end of the sequence. The receptors belonging to this family are characterized by interactions with G proteins and 7 hydrophobic transmembrane regions. This gene encodes the receptor for the tachykinin substance P, also referred to as neurokinin 1. This receptor is also involved in the mediation of phosphatidylinositol metabolism of substance P. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host_Name: | Mouse |
| Buffer: | 1X PBS pH 7.2 |
| ListPrice: | 295 |
| AppSummary: | ELISA |
| SpeciesSummary: | Hu |
| ALTnames: | anti-NK1R antibody, anti-NKIR antibody, anti-SPR antibody, anti-TAC1R antibody |
| ProteinTarget: | tachykinin receptor 1 |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 6869 |
| Gene_Symbol: | TACR1 |
| Omim_ID: | 162323, |
order or
more information: | company product webpage |
| request information: |
|