| request information: |
|
| Catalog Code: | H00006862-M08 |
| Product Name: | T Antibody |
| Product Description: | Mouse Monoclonal anti-T (5E12) |
| Clone: | 5E12 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 6862 |
| Gene Symbol: | T |
| Omim ID: | 601397, |
| Immunogen: | T (NP_003172, 222 a.a. ~ 321 a.a) partial recombinant protein with GST tag. |
| Epitope: | ERSDHKEMMEEPGDSQQPGYSQWGWLLPGTSTLCPPANPHPQFGGALSLPSTHSCDRYPTLRSHRSSPYPSPYAHRNNS
PTYSDNSPACLSMLQSHDNW* |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | The protein encoded by this gene is an embryonic nuclear transcription factor that binds to a specific DNA element, the palindromic T-site. It binds through a region in its N-terminus, called the T-box, and effects transcription of genes required for mesoderm formation and differentiation. The protein is localized to notochord-derived cells. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-MGC104817 antibody, anti-TFT antibody |
| Package Size: | 0.1 mg |
| Preservative: | No Preservative |
order or
more information: | company product webpage |