ExactAntigen

T Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00006862-M07
Product Type:Primary Antibody
Product Name:T Antibody
List Price:275
Clonality:Monoclonal
Gene ID:6862
Host:Mouse
Clone:6D3
Isotype:IgG2a Kappa
Product Description:Mouse Monoclonal anti-T (6D3)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:The protein encoded by this gene is an embryonic nuclear transcription factor that binds to a specific DNA element, the palindromic T-site. It binds through a region in its N-terminus, called the T-box, and effects transcription of genes required for meso
Alternate Names:anti-MGC104817 antibody, anti-TFT antibody
Immunogen:T (NP_003172, 222 a.a. ~ 321 a.a) partial recombinant protein with GST tag.
Epitope:ERSDHKEMMEEPGDSQQPGYSQWGWLLPGTSTLCPPANPHPQFGGALSLPSTHSCDRYPTLRSHRSSPYPSPYAHRNNSPTYSDNSPACLSMLQSHDNW* ...
Purity:IgG purified
Buffer:In 1x PBS, pH 7.2
Packaging:0.1 mg IgG purified Mouse ascites.
Package Size:0.1 mg
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:T
Omim ID:601397,
see all human T antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about