| request information: |
|
| Catalog Code: | H00006854-A01 |
| Product Name: | SYN2 Antibody |
| Product Description: | Mouse Polyclonal anti-SYN2 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 6854 |
| Gene Symbol: | SYN2 |
| Omim ID: | 181500, 600755, |
| Immunogen: | SYN2 (NP_598328, 348 a.a. ~ 449 a.a) partial recombinant protein with GST tag. |
| Epitope: | AMSDRYKLWVDTCSEMFGGLDICAVKAVHGKDGKDYIFEVMDCSMPLIGEHQVEDRQLITELVISKMNQLLSRTPALSP
QRPLTTQQPQSGTLKDPDSSKT* |
| Specificity: | SYN2 - synapsin II |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | This gene is a member of the synapsin gene family. Synapsins encode neuronal phosphoproteins which associate with the cytoplasmic surface of synaptic vesicles. Family members are characterized by common protein domains, and they are implicated in synaptogenesis and the modulation of neurotransmitter release, suggesting a potential role in several neuropsychiatric diseases. This member of the synapsin family encodes a neuron-specific phosphoprotein that selectively binds to small synaptic vesicles in the presynaptic nerve terminal. The TIMP4 gene is located within an intron of this gene and is transcribed in the opposite direction. Mutations in this gene may be associated with abnormal presynaptic function and schizophrenia. Alternative splicing of this gene results in two transcripts. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-SYNII antibody, anti-SYNIIa antibody, anti-SYNIIb antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |