ExactAntigen

Mouse Polyclonal anti-spleen tyrosine kinase | Novus Biologicals antibody product information
To request information:
enter your email address here
CatalogCode: H00006850-A01
ProductName: spleen tyrosine kinase Antibody
Product Description: Mouse Polyclonal anti-spleen tyrosine kinase
Clonality: Polyclonal
Immunogen: SYK (AAH01645, 243 a.a. ~ 341 a.a) partial recombinant protein with GST tag.
Epitope: HYSYKADGLLRVLTVPCQKIGTQGNVNFGGRPQLPGSHPATWSAGGIISRIKSYSFPKPGHRKSSPAQGNRQESTVSFNPYEPELAPWAADKGPQREA* ...
Specificity: spleen tyrosine kinase
CrossReactivity: Human. Other species not tested.
Packaging: 0.05 ml of mouse antisera with 50% glycerol.
Uses: The quality control of this antibody is limited to Western blot on the immunizing protein.
Abnova's recommended working dilutions for western analysis are as follows:
1:500 dilution for ascites
1:1000 for purified Ig
1:500-1:1000 for polysera
Other applications have not been tested.
Storage: Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Host_Name: Mouse
ListPrice: 225
AppSummary: ELISA, WB
SpeciesSummary: Hu
ProteinTarget: spleen tyrosine kinase
PackageSize: 0.05 ml
NotesMain: This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id: 6850
Gene_Symbol: SYK
Omim_ID: 600085,
more information: company product webpage
Also see:
see all human SYK antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about