| request information: |
|
| Catalog Code: | H00006840-M03 |
| Product Name: | SVIL Antibody |
| Product Description: | Mouse Monoclonal anti-SVIL (6E10) |
| Clone: | 6E10 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 6840 |
| Gene Symbol: | SVIL |
| Omim ID: | 604126, |
| Immunogen: | SVIL (NP_003165, 1679 a.a. ~ 1787 a.a) partial recombinant protein with GST tag. |
| Epitope: | LIHAGLEPLTFTNMFPSWEHREDIAEITEMDTEVSNQITLVEDVLAKLCKTIYPLADLLARPLPEGVDPLKLEIYLTDE
DFEFALDMTRDEYNALPAWKQVNLKKAKG* |
| Specificity: | SVIL - supervillin |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | This gene encodes a bipartite protein with distinct amino- and carboxy-terminal domains. The amino-terminus contains nuclear localization signals and the carboxy-terminus contains numerous consecutive sequences with extensive similarity to proteins in the gelsolin family of actin-binding proteins, which cap, nucleate, and/or sever actin filaments. The gene product is tightly associated with both actin filaments and plasma membranes, suggesting a role as a high-affinity link between the actin cytoskeleton and the membrane. The encoded protein appears to aid in both myosin II assembly during cell spreading and disassembly of focal adhesions. Two transcript variants encoding different isoforms of supervillin have been described. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-DKFZp686A17191 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |