ExactAntigen

SUPT5H Antibody | Novus Biologicals antibody product information
request information:
Catalog Code:H00006829-M03
Product Name:SUPT5H Antibody
Product Description:Mouse Monoclonal anti-SUPT5H (3B1)
Clone:3B1
Clonality:Monoclonal
ListPrice:295
Gene ID:6829
Gene Symbol:SUPT5H
Omim ID:602102,
Immunogen:SUPT5H (AAH24203, 981 a.a. ~ 1088 a.a) partial recombinant protein with GST tag.
Epitope:TTDIQVKVRDTYLDTQVVGQTGVIRSVTGGMCSVYLKDSEKVVSISSEHLEPITPTKNNKVKVILGEDREATGVLLSID
GEDGIVRMDLDEQLKILNLRFLGKLLEA*
Cross Reactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG2b Kappa
Host Name:Mouse
Buffer:In 1x PBS, pH 7.2
Application Summary:ELISA, immunofluorescence, Western Blot
Species Summary:Hu
Alternate Names:anti-SPT5 antibody, anti-SPT5H antibody
Package Size:0.1 mg
Preservative:No Preservative
order or
more information
:
company product webpage
Also see:
all human SUPT5H antibodies


2008©ExactAntigen home | browse | about