| request information: | |
| Catalog Code: | H00006829-M01 |
| Product Name: | SUPT5H Antibody |
| Product Description: | Mouse Monoclonal anti-SUPT5H (3F1) |
| Clone: | 3F1 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 6829 |
| Gene Symbol: | SUPT5H |
| Omim ID: | 602102, |
| Immunogen: | SUPT5H (AAH24203, 981 a.a. ~ 1088 a.a) partial recombinant protein with GST tag. |
| Epitope: | TTDIQVKVRDTYLDTQVVGQTGVIRSVTGGMCSVYLKDSEKVVSISSEHLEPITPTKNNKVKVILGEDREATGVLLSID GEDGIVRMDLDEQLKILNLRFLGKLLEA* |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2b Kappa |
| Host Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| Application Summary: | ELISA, immunofluorescence, Immunohistochemistry-Paraffin, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-SPT5 antibody, anti-SPT5H antibody, anti-SUPT5H antibody, anti-Suppressor of Ty 5 Homolog antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or more information: | company product webpage |