ExactAntigen

STX4A Antibody | Novus Biologicals antibody product information
request information:
Catalog Code:H00006810-A01
Product Name:STX4A Antibody
Product Description:Mouse Polyclonal anti-STX4A
Clonality:Polyclonal
ListPrice:225
Gene ID:6810
Gene Symbol:STX4A
Omim ID:186591,
Immunogen:STX4A (NP_004595, 19 a.a. ~ 120 a.a) partial recombinant protein with GST tag.
Epitope:DKERVALVVHPGTARLGSPDEEFFHKVRTIRQTIVKLGNKVQELEKQQVTILATPLPEESMKQELQNLRDEIKQLGREI
RLQLKAIEPQKEEADENYNSVN*
Specificity:STX4A - syntaxin 4A (placental)
Cross Reactivity:Human. Other species not tested.
Packaging:0.05 ml of mouse antisera with 50% glycerol. No preservative.
Uses:Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:Whole antisera
Host Name:Mouse
Application Summary:ELISA, Western Blot
Species Summary:Hu
Alternate Names:anti-p35-2 antibody
Package Size:0.05 ml
Preservative:No preservative
order or
more information
:
company product webpage
Also see:
all human STX4 antibodies


2008©ExactAntigen home | browse | about