| Catalog Code: | H00006804-M03 |
| Product Type: | Primary Antibody |
| Product Name: | STX1A Antibody |
| List Price: | 275 |
| Clonality: | Monoclonal |
| Gene ID: | 6804 |
| Host: | Mouse |
| Clone: | 2F12 |
| Isotype: | IgG2a Kappa |
| Product Description: | Mouse Monoclonal anti-STX1A (2F12) |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | Synaptic vesicles store neurotransmitters that are released during calcium-regulated exocytosis. The specificity of neurotransmitter release requires the localization of both synaptic vesicles and calcium channels to the presynaptic active zone. Syntaxins |
| Alternate Names: | anti-HPC-1 antibody, anti-STX1 antibody, anti-p35-1 antibody |
| Immunogen: | STX1A (-, 1 a.a. ~ 252 a.a) full length recombinant protein with GST tag. |
| Epitope: | MKDRTQELRTAKDSDDDDDVAVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQTMWRGPCLTPRRPSSTRARRAGRKS* ... |
| Purity: | IgG purified |
| Buffer: | In 1x PBS, pH 7.2 |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Package Size: | 0.1 mg |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Application Summary: | ELISA, WB |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug). |
| Gene Symbol: | STX1A |
| Omim ID: | 186590, |