| request information: |
|
| Catalog Code: | H00006804-M02 |
| Product Name: | STX1A Antibody |
| Product Description: | Mouse Monoclonal anti-STX1A (1B11-1A8) |
| Clone: | 1B11-1A8 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 6804 |
| Gene Symbol: | STX1A |
| Omim ID: | 186590 |
| Immunogen: | STX1A ( 1 a.a. ~ 252 a.a) full length recombinant protein with GST tag. |
| Epitope: | MKDRTQELRTAKDSDDDDDVAVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELM
SDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGR
TTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQTMWRGPCLTPR
RPSSTRARRAGRKS* |
| Specificity: | STX1A - syntaxin 1A (brain) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA. |
| Background: | Synaptic vesicles store neurotransmitters that are released during calcium-regulated exocytosis. The specificity of neurotransmitter release requires the localization of both synaptic vesicles and calcium channels to the presynaptic active zone. Syntaxins function in this vesicle fusion process. Syntaxins also serve as a substrate for botulinum neurotoxin type C, a metalloprotease that blocks exocytosis and has high affinity for a molecular complex that includes the alpha-latrotoxin receptor (MIM 600565) which produces explosive exocytosis (Zhang et al., 1995 [PubMed 7622072]).[supplied by OMIM] |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, immunofluorescence, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-STX1A antibody, anti-syntaxin 1A (brain)antibody, anti-HGNC:11433 antibody, anti-HPC-1 antibody, anti-STX1 antibody, anti-p35-1 antibody, anti-adipocyte antibody, anti-C1Q and collagen domain containing antibody, anti-adiponectin antibody, anti-adipose most abundant gene transcript 1 antibody, anti-syntaxin 1B2 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |