| Catalog Code: | H00006804-M01 |
| Product Type: | Primary Antibody |
| Product Name: | STX1A Antibody |
| List Price: | 275 |
| Clonality: | Monoclonal |
| Gene ID: | 6804 |
| Host: | Mouse |
| Clone: | 1F9-1C9 |
| Isotype: | IgG1 kappa |
| Product Description: | Mouse Monoclonal anti-STX1A (1F9-1C9) |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | NCBI Entrez Gene ID = STX1A PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.Synaptic vesicles s |
| Alternate Names: | anti-STX1A antibody, anti-syntaxin 1A (brain)antibody, anti-HGNC:11433 antibody, anti-HPC-1 antibody, anti-STX1 antibody, anti-p35-1 antibody, anti-adipocyte antibody, anti-C1Q and collagen domain containing antibody, anti-adiponectin antibody, anti-adipo |
| Immunogen: | STX1A ( 1 a.a. ~ 252 a.a) full length recombinant protein with GST tag. |
| Epitope: | MKDRTQELRTAKDSDDDDDVAVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQTMWRGPCLTPRRPSSTRARRAGRKS* ... |
| Specificity: | STX1A - syntaxin 1A (brain) |
| Purity: | Ascites |
| Packaging: | 100 ug purified IgG |
| Package Size: | 0.1 ml |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. This antibody has also been tested on transfected lysates |
| Application Summary: | ELISA, WB |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug). |
| Gene Symbol: | STX1A |
| Omim ID: | 186590 |