ExactAntigen

STX1A Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00006804-M01
Product Type:Primary Antibody
Product Name:STX1A Antibody
List Price:275
Clonality:Monoclonal
Gene ID:6804
Host:Mouse
Clone:1F9-1C9
Isotype:IgG1 kappa
Product Description:Mouse Monoclonal anti-STX1A (1F9-1C9)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = STX1A PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.Synaptic vesicles s
Alternate Names:anti-STX1A antibody, anti-syntaxin 1A (brain)antibody, anti-HGNC:11433 antibody, anti-HPC-1 antibody, anti-STX1 antibody, anti-p35-1 antibody, anti-adipocyte antibody, anti-C1Q and collagen domain containing antibody, anti-adiponectin antibody, anti-adipo
Immunogen:STX1A ( 1 a.a. ~ 252 a.a) full length recombinant protein with GST tag.
Epitope:MKDRTQELRTAKDSDDDDDVAVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQTMWRGPCLTPRRPSSTRARRAGRKS* ...
Specificity:STX1A - syntaxin 1A (brain)
Purity:Ascites
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. This antibody has also been tested on transfected lysates
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:STX1A
Omim ID:186590
see all human STX1A antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about