| CatalogCode: | H00006804-A01 |
| ProductName: | STX1A Antibody |
| Product Description: | Mouse Polyclonal anti-STX1A |
| Clonality: | Polyclonal |
| Immunogen: | STX1A (-, 1 a.a. ~ 252 a.a) full length recombinant protein with GST tag. |
| Epitope: | MKDRTQELRTAKDSDDDDDVAVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQTMWRGPCLTPRRPSSTRARRAGRKS* ... |
| Specificity: | STX1A - syntaxin 1A (brain) |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein.
Abnova's recommended working dilutions for western analysis are as follows:
1:500 dilution for ascites
1:1000 for purified Ig
1:500-1:1000 for polysera |
| Background: | Synaptic vesicles store neurotransmitters that are released during calcium-regulated exocytosis. The specificity of neurotransmitter release requires the localization of both synaptic vesicles and calcium channels to the presynaptic active zone. Syntaxins function in this vesicle fusion process. Syntaxins also serve as a substrate for botulinum neurotoxin type C, a metalloprotease that blocks exocytosis and has high affinity for a molecular complex that includes the alpha-latrotoxin receptor (MIM 600565) which produces explosive exocytosis (Zhang et al., 1995 [PubMed 7622072]).[supplied by OMIM] |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host_Name: | Mouse |
| ListPrice: | 225 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-STX1A antibody, anti-syntaxin 1A (brain)antibody, anti-HGNC:11433 antibody, anti-HPC-1 antibody, anti-STX1 antibody, anti-p35-1 antibody, anti-adipocyte antibody, anti-C1Q and collagen domain containing antibody, anti-adiponectin antibody, anti-adipose most abundant gene transcript 1 antibody, anti-syntaxin 1B2 antibody |
| ProteinTarget: | STX1A - syntaxin 1A (brain) |
| PackageSize: | 0.05 ml |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 6804 |
| Gene_Symbol: | STX1A |
| Omim_ID: | 186590 H00006804-M01 |
order or
more information: | company product webpage |
| request information: |
|