ExactAntigen

Mouse Polyclonal anti-STK11 | Novus Biologicals antibody product information
To request information:
enter your email address here
CatalogCode: H00006794-A02
ProductName: STK11 Antibody
Product Description: Mouse Polyclonal anti-STK11
Clonality: Polyclonal
Immunogen: STK11 (AAH07981, 321 a.a. ~ 434 a.a) partial recombinant protein with GST tag.
Epitope: PIPPSPDTKDRWRSMTVVPYLEDLHGADEDEDLFDIEDDIIYTQDFTVPGQVPEEEASHNGQRRGLPKAVCMNGTEAAQLSTKSRAEGRAPNPARKACSASSKIRRLSACKQQ* ...
Specificity: STK11 - serine/threonine kinase 11 (Peutz-Jeghers syndrome)
CrossReactivity: Human. Other species not tested.
Packaging: 0.05 ml of mouse antisera with 50% glycerol. No preservative.
Uses: The quality control of this antibody is limited to Western blot on the immunizing protein.
Abnova's recommended working dilutions for western analysis are as follows:
1:500 dilution for ascites
1:1000 for purified Ig
1:500-1:1000 for polysera
Background: This gene, which encodes a member of the serine/threonine kinase family, regulates cell polarity and functions as a tumor suppressor. Mutations in this gene have been associated with Peutz-Jeghers syndrome, an autosomal dominant disorder characterized by the growth of polyps in the gastrointestinal tract, pigmented macules on the skin and mouth, and other neoplasms. Alternate transcriptional splice variants of this gene have been observed but have not been thoroughly characterized.
Storage: Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity: Whole antisera
Host_Name: Mouse
ListPrice: 225
AppSummary: ELISA, WB
SpeciesSummary: Hu
ALTnames: anti-LKB1 antibody, anti-PJS antibody
ProteinTarget: STK11 - serine/threonine kinase 11 (Peutz-Jeghers syndrome)
PackageSize: 0.05 ml
NotesMain: This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id: 6794
Gene_Symbol: STK11
Omim_ID: 175200 602216
more information: company product webpage
Also see:
see all human LKB1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about