| request information: |
|
| Catalog Code: | H00006789-A01 |
| Product Name: | STK4 Antibody |
| Product Description: | Mouse Polyclonal anti-STK4 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 6789 |
| Gene Symbol: | STK4 |
| Omim ID: | 604965, |
| Immunogen: | STK4 (NP_006273, 391 a.a. ~ 486 a.a) partial recombinant protein with GST tag. |
| Epitope: | AKPSFLEYFEQKEKENQINSFGKSVPGPLKNSSDWKIPQDGDYEFLKSWTVEDLQKRLLALDPMMEQEIEEIRQKYQSK
RQPILDAIEAKKRRQQ* |
| Specificity: | Mouse polyclonal antibody raised against a partial recombinant STK4. |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | The protein encoded by this gene is a cytoplasmic kinase that is structurally similar to the yeast Ste20p kinase, which acts upstream of the stress-induced mitogen-activated protein kinase cascade. The encoded protein can phosphorylate myelin basic protein and undergoes autophosphorylation. A caspase-cleaved fragment of the encoded protein has been shown to be capable of phosphorylating histone H2B. The particular phosphorylation catalyzed by this protein has been correlated with apoptosis, and it's possible that this protein induces the chromatin condensation observed in this process. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-DKFZp686A2068 antibody, anti-KRS2 antibody, anti-MST1 antibody, anti-YSK3 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No Preservative |
order or
more information: | company product webpage |