| CatalogCode: | | H00006787-M02A |
| ProductName: | | NEK4 Antibody |
| Product Description: | | Mouse Monoclonal anti-NEK4 - NIMA (never in mitosis gene a)-related kinase 4 (2E9) |
| Clone: | | 2E9 |
| Clonality: | | Monoclonal |
| Immunogen: | | NEK4 (AAH63044, 680 a.a. ~ 781 a.a) partial recombinant protein with GST tag. |
| Epitope: | | DVPVANPVSEFKLHRKYRDTLILHGKVAEEAEEIHFKELPSAIMPGSEKIRRLVEVLRTDVIRGLGVQLLEQVYDLLEEEDEFDREVSVSLTVSRCLCYRIF ... |
| CrossReactivity: | | Human. |
| Packaging: | | 0.1 mg IgG purified Mouse ascites. |
| Uses: | | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Storage: | | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | | IgG purified |
| Isotype: | | IgG2a Kappa |
| Host_Name: | | Mouse |
| Buffer: | | In 1x PBS, pH 7.2 |
| ListPrice: | | 295 |
| AppSummary: | | ELISA, WB |
| SpeciesSummary: | | Hu |
| ALTnames: | | anti-MGC33171 antibody, anti-NRK2 antibody, anti-STK2 antibody, anti-pp12301 antibody |
| ProteinTarget: | | NIMA (never in mitosis gene a)-related kinase 4 |
| PackageSize: | | 0.1 mg |
| NotesMain: | | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | | 6787 |
| Gene_Symbol: | | NEK4 |
| more information: | | company product webpage |