| request information: |
|
| Catalog Code: | H00006787-M01 |
| Product Name: | NEK4 Antibody |
| Product Description: | Mouse Monoclonal anti-NEK4 (1B8) |
| Clone: | 1B8 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 6787 |
| Gene Symbol: | NEK4 |
| Omim ID: | 601959, |
| Immunogen: | NEK4 (AAH63044, 680 a.a. ~ 781 a.a) partial recombinant protein with GST tag. |
| Epitope: | DVPVANPVSEFKLHRKYRDTLILHGKVAEEAEEIHFKELPSAIMPGSEKIRRLVEVLRTDVIRGLGVQLLEQVYDLLEE
EDEFDREVSVSLTVSRCLCYRIF |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-MGC33171 antibody, anti-NRK2 antibody, anti-STK2 antibody, anti-pp12301 antibody |
| Package Size: | 0.05 mg |
| Preservative: | No Preservative |
order or
more information: | company product webpage |