| request information: |
|
| Catalog Code: | H00006778-A01 |
| Product Name: | STAT6 Antibody |
| Product Description: | Mouse Polyclonal anti-STAT6 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 6778 |
| Gene Symbol: | STAT6 |
| Omim ID: | 601512 |
| Immunogen: | STAT6 (NP_003144, 694 a.a. ~ 802 a.a) partial recombinant protein with GST tag. |
| Epitope: | PPHSHSIPPYQGLSPEESVNVLSAFQEPHLQMPPSLGQMSLPFDQPHPQGLLPCQPQEHAVSSPDPLLCSDVTMVEDSC
LSQPVTAFPQGTWIGEDIFPPLLPPTEQD* |
| Specificity: | STAT6 - signal transducer and activator of transcription 6, interleukin-4 induced |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | The protein encoded by this gene is a member of the STAT family of transcription factors. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein plays a central role in exerting IL4 mediated biological responses. It is found to induce the expression of BCL2L1/BCL-X(L), which is responsible for the anti-apoptotic activity of IL4. Knockout studies in mice suggested the roles of this gene in differentiation of T helper 2 (Th2) cells, expression of cell surface markers, and class switch of immunoglobulins. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-STAT6 antibody, anti-STAT6C antibody, anti-D12S1644 antibody, anti-IL-4-STAT antibody, anti-interleukin 4 induced STATantibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |