| request information: |
|
| Catalog Code: | H00006776-M01 |
| Product Name: | STAT5A Antibody |
| Product Description: | Mouse Monoclonal anti-STAT5A (1E3) |
| Clone: | 1E3 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 6776 |
| Gene Symbol: | STAT5A |
| Omim ID: | 601511, |
| Immunogen: | STAT5A (AAH27036, 1 a.a. ~ 104 a.a) partial recombinant protein with GST tag. |
| Epitope: | MAGWIQAQQLQGDALRQMQVLYGQHFPIEVRHYLAQWIESQP WDAIDLDNPQDRAQATQLLEGLVQELQKKAEHQVGEDGFLLK IKLGHYATQLQKTYDRCPLE |
| Specificity: | STAT5A - signal transducer and activator of transcription 5A |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against transfected lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA. |
| Localization: | Cytoplasmic, translocated into the nucleus in response to phosphorylation. |
| Background: | The protein encoded by this gene is a member of the STAT family of transcription factors. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein is activated by, and mediates the responses of many cell ligands, such as IL2, IL3, IL7 GM-CSF, erythropoietin, thrombopoietin, and different growth hormones. Activation of this protein in myeloma and lymphoma associated with a TEL/JAK2 gene fusion is independent of cell stimulus and has been shown to be essential for the tumorigenesis. The mouse counterpart of this gene is found to induce the expression of BCL2L1/BCL-X(L), which suggests the antiapoptotic function of this gene in cells. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 kappa |
| Host Name: | Mouse |
| Buffer: | Phosphate buffered saline, pH 7.2 |
| Application Summary: | ELISA, Immunohistochemistry-Paraffin, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-Mammary gland factor antibody, anti-MGF antibody, anti-Signal transducer and activator of transcription 5A antibody, anti-STAT 5 antibody, anti-STAT 5A antibody, anti-STAT5 antibody |
| Package Size: | 0.05 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |