ExactAntigen

STAT3 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00006774-M01
Product Type:Primary Antibody
Product Name:STAT3 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:6774
Host:Mouse
Clone:1D11-2A11
Isotype:IgG2b kappa
Product Description:Mouse Monoclonal anti-STAT3 (1D11-2A11)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = STAT3 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.The protein encoded
Alternate Names:anti-STAT3 antibody, anti-signal transducer and activator of transcription 3 (acute-phase response factor) antibody, anti-APRF antibody, anti-FLJ20882 antibody, anti-MGC16063antibody, anti-DNA-binding protein APRF antibody, anti-acute-phase response facto
Immunogen:STAT3 (AAH00627, 1 a.a. ~ 770 a.a) full length recombinant protein with GST tag.
Epitope:MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNLLGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLKSQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEELADWKRRQQIACIGGP ...
Specificity:STAT3 - signal transducer and activator of transcription 3 (acute-phase response factor)
Purity:IgG purified
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:STAT3
Omim ID:102582,
see all human STAT3 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about