| request information: |
|
| Catalog Code: | H00006773-M01 |
| Product Name: | STAT2 Antibody |
| Product Description: | Mouse Monoclonal anti-STAT2 (5G7) |
| Clone: | 5G7 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 6773 |
| Gene Symbol: | STAT2 |
| Omim ID: | 600556, |
| Immunogen: | STAT2 (AAH51284, 742 a.a. ~ 851 a.a) partial recombinant protein with GST tag. |
| Epitope: | KAGLDLGPELESVLESTLEPVIEPTLCMVSQTVPEPDQGPVSQPVPEPDLPCDLRHLNTEPMEIFRNCVKIEEIMPNGD
PLLAGQNTVDEVYVSRPSHFYTDGPLMPSDF |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA. |
| Background: | The protein encoded by this gene is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. In response to interferon (IFN), this protein forms a complex with STAT1 and IFN regulatory factor family protein p48 (ISGF3G), in which this protein acts as a transactivator, but lacks the ability to bind DNA directly. Transcription adaptor P300/CBP (EP300/CREBBP) has been shown to interact specifically with this protein, which is thought to be involved in the process of blocking IFN-alpha response by adenovirus. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| Application Summary: | ELISA, immunofluorescence, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-ISGF-3 antibody, anti-MGC59816 antibody, anti-P113 antibody, anti-STAT113 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |