| request information: |
|
| Catalog Code: | H00006772-M01 |
| Product Name: | STAT1 Antibody |
| Product Description: | Mouse Monoclonal anti-STAT1 (1A8) |
| Clone: | 1A8 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 6772 |
| Gene Symbol: | STAT1 |
| Omim ID: | 209,950,600,555 |
| Immunogen: | STAT1 (AAH02704, 613 a.a. ~ 712 a.a) partial recombinant protein with GST tag. |
| Epitope: | TFTWVERSQNGGEPDFHAVEPYTKKELSAVTFPDIIRNYKVMAAENIPENPLKYLYPNIDKDHAFGKYYSRPKEAPEPM
ELDGPKGTGYIKTELISVSEV |
| Specificity: | STAT1 - signal transducer and activator of transcription 1, 91kDa |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA. |
| Background: | The protein encoded by this gene is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein can be activated by various ligands including interferon-alpha, interferon-gamma, EGF, PDGF and IL6. This protein mediates the expression of a variety of genes, which is thought to be important for cell viability in response to different cell stimuli and pathogens. Two alternatively spliced transcript variants encoding distinct isoforms have been described. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, immunofluorescence, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-ISGF 3 antibody, anti-Signal Transductor and Activator of Transcription 1 antibody, anti-DKFZp686B04100 antibody, anti-STAT91 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |