ExactAntigen

Mouse Polyclonal anti-STAT1 | Novus Biologicals antibody product information
To request information:
enter your email address here
CatalogCode: H00006772-A01
ProductName: STAT1 Antibody
Product Description: Mouse Polyclonal anti-STAT1
Clonality: Polyclonal
Immunogen: STAT1 (AAH02704, 613 a.a. ~ 712 a.a) partial recombinant protein with GST tag.
Epitope: TFTWVERSQNGGEPDFHAVEPYTKKELSAVTFPDIIRNYKVMAAENIPENPLKYLYPNIDKDHAFGKYYSRPKEAPEPMELDGPKGTGYIKTELISVSEV ...
Specificity: STAT1 - signal transducer and activator of transcription 1, 91kDa
CrossReactivity: Human. Other species not tested.
Packaging: 0.05 ml of mouse antisera with 50% glycerol. No preservative.
Uses: The quality control of this antibody is limited to Western blot on the immunizing protein.
Abnova's recommended working dilutions for western analysis are as follows:
1:500 dilution for ascites
1:1000 for purified Ig
1:500-1:1000 for polysera
Background: The protein encoded by this gene is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein can be activated by various ligands including interferon-alpha, interferon-gamma, EGF, PDGF and IL6. This protein mediates the expression of a variety of genes, which is thought to be important for cell viability in response to different cell stimuli and pathogens. Two alternatively spliced transcript variants encoding distinct isoforms have been described.
Storage: Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity: Whole antisera
Host_Name: Mouse
ListPrice: 225
AppSummary: ELISA, WB
SpeciesSummary: Hu
ALTnames: anti-ISGF 3 antibody, anti-Signal Transductor and Activator of Transcription 1 antibody, anti-DKFZp686B04100 antibody, anti-STAT91 antibody
ProteinTarget: STAT1 - signal transducer and activator of transcription 1, 91kDa
PackageSize: 0.05 ml
NotesMain: This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id: 6772
Gene_Symbol: STAT1
Omim_ID: 209950 600555
more information: company product webpage
Also see:
see all human STAT1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about