| CatalogCode: | | H00006772-A01 |
| ProductName: | | STAT1 Antibody |
| Product Description: | | Mouse Polyclonal anti-STAT1 |
| Clonality: | | Polyclonal |
| Immunogen: | | STAT1 (AAH02704, 613 a.a. ~ 712 a.a) partial recombinant protein with GST tag. |
| Epitope: | | TFTWVERSQNGGEPDFHAVEPYTKKELSAVTFPDIIRNYKVMAAENIPENPLKYLYPNIDKDHAFGKYYSRPKEAPEPMELDGPKGTGYIKTELISVSEV ... |
| Specificity: | | STAT1 - signal transducer and activator of transcription 1, 91kDa |
| CrossReactivity: | | Human. Other species not tested. |
| Packaging: | | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnova's recommended working dilutions for western analysis are as follows: 1:500 dilution for ascites 1:1000 for purified Ig 1:500-1:1000 for polysera |
| Background: | | The protein encoded by this gene is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein can be activated by various ligands including interferon-alpha, interferon-gamma, EGF, PDGF and IL6. This protein mediates the expression of a variety of genes, which is thought to be important for cell viability in response to different cell stimuli and pathogens. Two alternatively spliced transcript variants encoding distinct isoforms have been described. |
| Storage: | | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | | Whole antisera |
| Host_Name: | | Mouse |
| ListPrice: | | 225 |
| AppSummary: | | ELISA, WB |
| SpeciesSummary: | | Hu |
| ALTnames: | | anti-ISGF 3 antibody, anti-Signal Transductor and Activator of Transcription 1 antibody, anti-DKFZp686B04100 antibody, anti-STAT91 antibody |
| ProteinTarget: | | STAT1 - signal transducer and activator of transcription 1, 91kDa |
| PackageSize: | | 0.05 ml |
| NotesMain: | | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | | 6772 |
| Gene_Symbol: | | STAT1 |
| Omim_ID: | | 209950 600555 |
| more information: | | company product webpage |