| CatalogCode: | H00006764-M01 |
| ProductName: | ST5 Antibody |
| Product Description: | Mouse Monoclonal anti-ST5 (1A3) |
| Clone: | 1A3 |
| Clonality: | Monoclonal |
| Immunogen: | ST5 (NP_005409, 1038 a.a. ~ 1136 a.a) partial recombinant protein with GST tag. |
| Epitope: | VGHYSLFLTQSEKGERAFQREAFRKSVASKSIRRFLEVFMESQMFAGFIQDRELRKCRAKGLFEQRVEQYLEELPDTEQSGMNKFLRGLGNKMKFLHK* ... |
| Specificity: | ST5 - suppression of tumorigenicity 5 |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein on ELISA. |
| Background: | This gene was identified by its ability to suppress the tumorigenicity of Hela cells in nude mice. The protein encoded by this gene contains a C-terminal region that shares similarity with the Rab 3 family of small GTP binding proteins. This protein preferentially binds to the SH3 domain of c-Abl kinase, and acts as a regulator of MAPK1/ERK2 kinase, which may contribute to its ability to reduce the tumorigenic phenotype in cells. Three alternatively spliced transcript variants of this gene encoding distinct isoforms are identified. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host_Name: | Mouse |
| ListPrice: | 295 |
| AppSummary: | ELISA |
| SpeciesSummary: | Hu |
| ALTnames: | anti-DENND2B antibody, anti-HTS1 antibody, anti-MGC33090 antibody, anti-p126 antibody |
| ProteinTarget: | ST5 - suppression of tumorigenicity 5 |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 6764 |
| Gene_Symbol: | ST5 |
| Omim_ID: | 140750, |
order or
more information: | company product webpage |
| request information: |
|