ExactAntigen

Mouse Monoclonal anti-SSX4 (3E10) | Novus Biologicals antibody product information
To request information:
enter your email address here
CatalogCode: H00006759-M02
ProductName: SSX4 Antibody
Product Description: Mouse Monoclonal anti-SSX4 (3E10)
Clone: 3E10
Clonality: Monoclonal
Immunogen: SSX4 (NP_005627, 91 a.a. ~ 189 a.a) partial recombinant protein with GST tag.
Epitope: RNQVERPQMTFGSLQRIFPKIMPKKPAEEENGLKEVPEASGPQNDGKQLCPPGNPSTLEKINKTSGPKRGKHAWTHRLRERKQLVVYEEISDPEEDDE* ...
Specificity: SSX4 - synovial sarcoma, X breakpoint 4
CrossReactivity: Human. Other species not tested.
Packaging: 0.1 mg IgG purified Mouse ascites.
Uses: Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Background: The product of this gene belongs to the family of highly homologous synovial sarcoma X (SSX) breakpoint proteins. These proteins may function as transcriptional repressors. They are also capable of eliciting spontaneously humoral and cellular immune responses in cancer patients, and are potentially useful targets in cancer vaccine-based immunotherapy. SSX1, SSX2 and SSX4 genes have been involved in the t(X;18) translocation characteristically found in all synovial sarcomas. This translocation results in the fusion of the synovial sarcoma translocation gene on chromosome 18 to one of the SSX genes on chromosome X. Chromosome Xp11 contains a segmental duplication resulting in two identical copies of synovial sarcoma, X breakpoint 4, SSX4 and SSX4B, in tail-to-tail orientation. This gene, SSX4, represents the more telomeric copy. Two transcript variants encoding distinct isoforms have been identified for this gene.
Storage: Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity: IgG purified
Isotype: IgG2a Kappa
Host_Name: Mouse
ListPrice: 295
AppSummary: ELISA, WB
SpeciesSummary: Hu
ALTnames: anti-MGC12411 antibody
ProteinTarget: SSX4 - synovial sarcoma, X breakpoint 4
PackageSize: 0.1 mg
NotesMain: This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id: 6759
Gene_Symbol: SSX4
Omim_ID: 300326,
more information: company product webpage
Also see:
see all human SSX4 antibodies
see all human SSX4B antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about