| request information: |
|
| Catalog Code: | H00006757-B01 |
| Product Name: | SSX2 Antibody |
| Product Description: | Mouse Polyclonal anti-SSX2 - synovial sarcoma, X breakpoint 2 |
| Clone: | synovial sarcoma, X breakpoint 2 |
| Clonality: | Polyclonal |
| ListPrice: | 295 |
| Gene ID: | 6757 |
| Gene Symbol: | SSX2 |
| Immunogen: | SSX2 (AAH02818, 1 a.a. ~ 224 a.a) full-length human protein.MW of the GST tag alone is 26 KDa. |
| Epitope: | MNGDDAFARRPTVGAQIPEKIQKAFDDIAKYFSKEEWEKMKASEKIFYVYMKRKYEAMTKLGFKATLPPFMCNKRAEDF
QGNDLDNDPNRGNQVERPQMTFGRLQGISPKIMPKKPAEEGNDSEEVPEASGPQNDGKELCPPGKPTTSEKIHERSGNR
EAQEKEERRGTAHRWSSQNTHNIGRFSLSTSMGAVHGTPKTITHNRDPKGGNMPGPTDCVRENSW* |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | The product of this gene belongs to the family of highly homologous synovial sarcoma X (SSX) breakpoint proteins. These proteins may function as transcriptional repressors. They are also capable of eliciting spontaneously humoral and cellular immune responses in cancer patients, and are potentially useful targets in cancer vaccine-based immunotherapy. SSX1, SSX2 and SSX4 genes have been involved in the t(X;18) translocation characteristically found in all synovial sarcomas. This translocation results in the fusion of the synovial sarcoma translocation gene on chromosome 18 to one of the SSX genes on chromosome X. The encoded hybrid proteins are probably responsible for transforming activity. Two transcript variants encoding distinct isoforms have been identified for this gene. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host Name: | Mouse |
| Application Summary: | Western Blot, ELISA |
| Species Summary: | Hu |
| Alternate Names: | anti-HD21 antibody, anti-HOM-MEL-40 antibody, anti-MGC119055 antibody, anti-MGC15364 antibody, anti-MGC3884 antibody, anti-SSX antibody |
| Package Size: | 0.05 ml |
| Preservative: | No Preservative |
order or
more information: | company product webpage |