| request information: |
|
| Catalog Code: | H00006748-M01 |
| Product Name: | SSR4 Antibody |
| Product Description: | Mouse Monoclonal anti-SSR4 (2D3) |
| Clone: | 2D3 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 6748 |
| Gene Symbol: | SSR4 |
| Omim ID: | 300090, |
| Immunogen: | SSR4 (AAH03371, 24 a.a. ~ 174 a.a) full length recombinant protein with GST tag. |
| Epitope: | EACLEPQITPSYYTTSDAVISTETVFIVEISLTCKNRVQNMA LYADVGGKQFPVTRGQDVGRYQVSWSLDHKSAHAGTYEVRFF DEESYSLLRKAQRNNEDISIIPPLFTVSVDHRGTWNGPWVST EVLAAAIGLVIYYLAFSAKSHIQA* |
| Specificity: | SSR4 - signal sequence receptor, delta (translocon-associated protein delta) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA. |
| Localization: | Endoplasmic reticulum |
| Background: | SSR4, also called TRAPD, is assumed to be involved in protein secretion. It is located in the Xq28 region, arranged in a compact head-to-head manner with the IDH3G gene. These two genes are driven by a bidirectional promoter located between them, and encode proteins involved in unrelated biochemical pathways located in different compartments of the cell. The nontranscribed intergenic region represents only 133 bp and is embedded in a CpG island. The CpG island functions as a bidirectional promoter to initiate the transcription of both functionally unrelated genes with distinct expression patterns. SSR4 consists of six exons and is approximately 70 kb telomeric to the ALD gene. Although alternative splicing of exon 5 has not been detected in human SSR4, transcript variants missing the region homologous to human exon 5 have been detected in both Xenopus laevis and Mus musculus. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host Name: | Mouse |
| Buffer: | Phosphate buffered saline, pH 7.2 |
| Application Summary: | ELISA, immunofluorescence, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-Signal sequence receptor delta antibody, anti-signal sequence receptor delta antibody, anti-Signal sequence receptor subunit delta antibody, anti-SSR delta antibody, anti-SSR4 antibody, anti-translocon associated protein delta antibody, anti-TRAP delta antibody, anti-TRAPD antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |